PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR11G03230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family M-type_MADS
Protein Properties Length: 150aa    MW: 17205.6 Da    PI: 10.6044
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR11G03230.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF44.81.6e-141050242
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                     +i n+ +r  tf k ++g++KKA+EL +LC+++ ++i+ ++
  LPERR11G03230.1 10 QILNDAQRRATFKKWLKGLMKKAKELATLCGMDTCLIVHGK 50
                     58899*********************************986 PP

2SRF-TF43.54.1e-1478117342
                      --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
           SRF-TF   3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42 
                      i n  +r  tf kR++g++KK +EL +LC ++ ++i++++
  LPERR11G03230.1  78 ILNGAQRRATFKKRLKGLMKKDKELATLCFMDTCLIVYGK 117
                      778899********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.96E-16160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.021147IPR002100Transcription factor, MADS-box
SMARTSM004324.3E-11161IPR002100Transcription factor, MADS-box
CDDcd002667.26E-17260No hitNo description
PfamPF003191.2E-131149IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.76968116IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.27E-1668145IPR002100Transcription factor, MADS-box
SMARTSM004323.1E-968127IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-87090IPR002100Transcription factor, MADS-box
PfamPF003191.6E-1278121IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-890105IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MTRGRVKLQQ ILNDAQRRAT FKKWLKGLMK KAKELATLCG MDTCLIVHGK GEAHVTEVWP  60
LILEAANMTR GRVKLQQILN GAQRRATFKK RLKGLMKKDK ELATLCFMDT CLIVYGKGEA  120
YATEVWPLIL EAASVLEHFM AIPWKEYTRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629573.13e-26PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A0D9XP991e-108A0A0D9XP99_9ORYZ; Uncharacterized protein
STRINGOB03G33030.11e-26(Oryza brachyantha)
STRINGORGLA03G0226500.12e-26(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36336202
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.11e-09AGAMOUS-like 80